skills/pdb/SKILL.md
3D protein structure search via RCSB PDB. Input MUST be a protein/gene name (e.g. 'KRAS', 'EGFR', 'BTK') or a 4-character PDB ID (e.g. '6OIM'). Returns zero results for drug/chemistry phrases such as 'covalent inhibitors' or 'warhead selectivity'. Strip all drug qualifiers and pass only the target protein name or PDB ID.
npx skillsauth add lamm-mit/scienceclaw pdbInstall this skill globally with one command. Works with Claude Code, Cursor, and Windsurf.
3 of 9 scanners reported clean
Some scanners were skipped, did not run, or reported a non-clean status. Review each row below.
Search and fetch protein structures from the RCSB Protein Data Bank.
python3 {baseDir}/scripts/pdb_search.py --query "kinase human"
python3 {baseDir}/scripts/pdb_search.py --pdb-id 1ATP
python3 {baseDir}/scripts/pdb_search.py --sequence "MTEYKLVVVGAGGVGKSALTIQLIQ" --identity 70
| Parameter | Description | Default |
|-----------|-------------|---------|
| --query | Text search query | - |
| --pdb-id | Specific PDB ID to fetch | - |
| --sequence | Sequence for similarity search | - |
| --identity | Minimum sequence identity % | 90 |
| --max-results | Maximum results | 10 |
| --format | Output: summary, detailed, json | summary |
# Search for insulin structures
python3 {baseDir}/scripts/pdb_search.py --query "insulin"
# Get details for a specific structure
python3 {baseDir}/scripts/pdb_search.py --pdb-id 4HHB
# Find structures similar to a sequence
python3 {baseDir}/scripts/pdb_search.py --sequence "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" --identity 50
# Get JSON output
python3 {baseDir}/scripts/pdb_search.py --query "p53 DNA binding" --format json
PDB stores experimentally determined 3D structures. Queries must target proteins or genes with known deposited structures. Abstract or chemistry-only queries return zero results.
| ❌ Fails | ✅ Works | |---|---| | "BTK covalent inhibitor" | "BTK" or "Bruton tyrosine kinase" | | "warhead optimization" | "1K2P" (direct PDB ID) | | "ADMET prediction" | "EGFR kinase inhibitor complex" |
Tips for avoiding zero results:
"BTK", "p53", "EGFR"--pdb-id 3K54) when you already have one from UniProt cross-refs"kinase" instead of "covalent kinase inhibitor BTK"tools
Onboard and manage Paperclip AI for research-paper knowledge and agent orchestration
development
Perform AI-powered web searches with real-time information using Perplexity models via LiteLLM and OpenRouter. This skill should be used when conducting web searches for current information, finding recent scientific literature, getting grounded answers with source citations, or accessing information beyond the model knowledge cutoff. Provides access to multiple Perplexity models including Sonar Pro, Sonar Pro Search (advanced agentic search), and Sonar Reasoning Pro through a single OpenRouter API key.
testing
Generate a structured scientific PDF report from a JSON description. Accepts a JSON file specifying title, authors, abstract, sections (headings, text, tables, figures), and inline data panels (heatmap, bar, scatter, line). Produces a publication-style A4 PDF using reportlab with no LaTeX dependency. All figures are either loaded from PNG paths or generated on-the-fly from inline data.
development
Execute arbitrary Python code and return stdout. NumPy, pandas, scipy, matplotlib, and other scientific libraries are available.